FAM83F Antikörper (Middle Region)

Produktnummer ABIN632716

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FAM83F in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für FAM83F Antikörper (Middle Region) (ABIN632716)

Target: FAM83F (Family with Sequence Similarity 83, Member F (FAM83F))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM83F Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM83F Antikörper

Bindungsspezifität: Middle Region

Spezifität: FAM83 F antibody was raised against the middle region of FAM83

Aufreinigung: Affinity purified

Immunogen: FAM83 F antibody was raised using the middle region of FAM83 corresponding to a region with amino acids FRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLINPKYALVSGCRHPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM83F Blocking Peptide, catalog no. 33R-3043, is also available for use as a blocking control in assays to test for specificity of this FAM83F antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM83F

Target: FAM83F (Family with Sequence Similarity 83, Member F (FAM83F))

Andere Bezeichnung: FAM83F

Hintergrund: The function of FAM83F protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 55 kDa (MW of target protein)