FAM83F Antikörper (N-Term)

Produktnummer ABIN632545

Produktdetails anti-FAM83F Antikörper

Target: FAM83F (Family with Sequence Similarity 83, Member F (FAM83F))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM83F Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM83 F antibody was raised against the N terminal of FAM83

Aufreinigung: Affinity purified

Immunogen: FAM83 F antibody was raised using the N terminal of FAM83 corresponding to a region with amino acids KDEKAPHLKQVVRQMIQQAQKVIAVVMDLFTDGDIFQDIVDAACKRRVPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM83F Blocking Peptide, catalog no. 33R-4281, is also available for use as a blocking control in assays to test for specificity of this FAM83F antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM83F

Target: FAM83F (Family with Sequence Similarity 83, Member F (FAM83F))

Andere Bezeichnung: FAM83F (FAM83F Produkte)

Synonyme: AW544981 antikoerper, RGD1562089 antikoerper, zgc:92122 antikoerper, family with sequence similarity 83, member F antikoerper, family with sequence similarity 83 member F antikoerper, family with sequence similarity 83, member Fb antikoerper, Fam83f antikoerper, FAM83F antikoerper, fam83fb antikoerper

Hintergrund: The function of FAM83F protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 55 kDa (MW of target protein)