DYNC1I1 Antikörper (N-Term)

Produktnummer ABIN632697

Dieses Anti-DYNC1I1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DYNC1I1 in WB. Geeignet für Human und Maus.

Kurzübersicht für DYNC1I1 Antikörper (N-Term) (ABIN632697)

Target: DYNC1I1 (Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DYNC1I1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DYNC1I1 Antikörper

Bindungsspezifität: N-Term

Spezifität: DYNC1 I1 antibody was raised against the N terminal of DYNC1 1

Aufreinigung: Affinity purified

Immunogen: DYNC1 I1 antibody was raised using the N terminal of DYNC1 1 corresponding to a region with amino acids IREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DYNC1I1 Blocking Peptide, (ABIN939516), is also available for use as a blocking control in assays to test for specificity of this DYNC1I1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNC0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DYNC1I1

Target: DYNC1I1 (Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1))

Andere Bezeichnung: DYNC1I1

Hintergrund: DYNC1I1 belongs to the dynein intermediate chain family. It contains 7 WD repeats. The intermediate chains seem to help dynein bind to dynactin 150 kDa component. DYNC1I1 may play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.

Molekulargewicht: 73 kDa (MW of target protein)