HOMER1 Antikörper

Produktnummer ABIN632669

Der Kaninchen Polyklonal Anti-HOMER1 Antikörper wurde für WB validiert. Er ist geeignet, HOMER1 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für HOMER1 Antikörper (ABIN632669)

Target: HOMER1 (Homer Homolog 1 (HOMER1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HOMER1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HOMER1 Antikörper

Aufreinigung: Affinity purified

Immunogen: HOMER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD

Anwendungsinformationen

Applikationshinweise: WB: 0.0156 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HOMER1 Blocking Peptide, (ABIN937888), is also available for use as a blocking control in assays to test for specificity of this HOMER1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HOMER1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HOMER1

Target: HOMER1 (Homer Homolog 1 (HOMER1))

Andere Bezeichnung: HOMER1

Hintergrund: HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development