ADPRM Antikörper (Middle Region)

Produktnummer ABIN632664

Dieses Anti-ADPRM-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ADPRM in WB. Geeignet für Human. Dieses Primary Antibody wurde in 1 Publikation zitiert.

Kurzübersicht für ADPRM Antikörper (Middle Region) (ABIN632664)

Target: ADPRM (C17orf48) (Chromosome 17 Open Reading Frame 48 (C17orf48))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADPRM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ADPRM Antikörper

Bindungsspezifität: Middle Region

Spezifität: C17 ORF48 antibody was raised against the middle region of C17 rf48

Aufreinigung: Affinity purified

Immunogen: C17 ORF48 antibody was raised using the middle region of C17 rf48 corresponding to a region with amino acids KYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C17ORF48 Blocking Peptide, (ABIN940124), is also available for use as a blocking control in assays to test for specificity of this C17ORF48 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF48 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-ADPRM Antikörper (ABIN632664)

Haddon, Jarrell, Diep, Wand, Price, Tangsombatvisit, Credo, Mackey, Dekker, Baechler, Liu, Varma, Utz: "Mapping epitopes of U1-70K autoantibodies at single-amino acid resolution." in: Autoimmunity, Vol. 48, Issue 8, pp. 513-23, (2016) (PubMed).

Details zu ADPRM

Target: ADPRM (C17orf48) (Chromosome 17 Open Reading Frame 48 (C17orf48))

Andere Bezeichnung: C17ORF48

Hintergrund: The C17ORF48 protein hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress.

Molekulargewicht: 39 kDa (MW of target protein)