ADPRM Antikörper (N-Term)

Produktnummer ABIN632213

Produktdetails anti-ADPRM Antikörper

Target: ADPRM (C17orf48) (Chromosome 17 Open Reading Frame 48 (C17orf48))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADPRM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C17 ORF48 antibody was raised against the N terminal Of C17 rf48

Aufreinigung: Affinity purified

Immunogen: C17 ORF48 antibody was raised using the N terminal Of C17 rf48 corresponding to a region with amino acids MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C17ORF48 Blocking Peptide, catalog no. 33R-5825, is also available for use as a blocking control in assays to test for specificity of this C17ORF48 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF48 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADPRM

Target: ADPRM (C17orf48) (Chromosome 17 Open Reading Frame 48 (C17orf48))

Andere Bezeichnung: C17ORF48 (C17orf48 Produkte)

Synonyme: 2310004I24Rik antikoerper, MDS006 antikoerper, C17orf48 antikoerper, NBLA03831 antikoerper, C19H17orf48 antikoerper, ADPRibase-Mn antikoerper, RGD1309906 antikoerper, c17orf48 antikoerper, mds006 antikoerper, ADP-ribose/CDP-alcohol diphosphatase, manganese dependent antikoerper, ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent antikoerper, ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent L homeolog antikoerper, Adprm antikoerper, ADPRM antikoerper, adprm.L antikoerper

Hintergrund: C17ORF48 hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress.

Molekulargewicht: 39 kDa (MW of target protein)