TMC8 Antikörper (N-Term)

Produktnummer ABIN632629

Produktdetails anti-TMC8 Antikörper

Target: TMC8 (Transmembrane Channel-Like 8 (TMC8))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMC8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMC8 antibody was raised against the N terminal of TMC8

Aufreinigung: Affinity purified

Immunogen: TMC8 antibody was raised using the N terminal of TMC8 corresponding to a region with amino acids PGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMC8 Blocking Peptide, catalog no. 33R-7123, is also available for use as a blocking control in assays to test for specificity of this TMC8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMC8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMC8

Target: TMC8 (Transmembrane Channel-Like 8 (TMC8))

Andere Bezeichnung: TMC8 (TMC8 Produkte)

Synonyme: EV2 antikoerper, EVER2 antikoerper, EVIN2 antikoerper, Ever2 antikoerper, mFLJ00400 antikoerper, transmembrane channel like 8 antikoerper, transmembrane channel-like 8 antikoerper, transmembrane channel-like gene family 8 antikoerper, TMC8 antikoerper, Tmc8 antikoerper

Hintergrund: Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in either of two adjacent genes located on chromosome 17q25.3. Both of these genes encode integral membrane proteins that localize to the endoplasmic reticulum and are predicted to form transmembrane channels.

Molekulargewicht: 82 kDa (MW of target protein)