MTRR Antikörper (N-Term)

Produktnummer ABIN632593

Produktdetails anti-MTRR Antikörper

Target: MTRR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase Reductase (MTRR))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTRR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MTRR antibody was raised against the N terminal of MTRR

Aufreinigung: Affinity purified

Immunogen: MTRR antibody was raised using the N terminal of MTRR corresponding to a region with amino acids YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTRR Blocking Peptide, catalog no. 33R-10071, is also available for use as a blocking control in assays to test for specificity of this MTRR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTRR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTRR

Target: MTRR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase Reductase (MTRR))

Andere Bezeichnung: MTRR (MTRR Produkte)

Synonyme: MSR antikoerper, 4732420G08 antikoerper, cblE antikoerper, MTRR antikoerper, 5-methyltetrahydrofolate-homocysteine methyltransferase reductase antikoerper, Mtrr antikoerper, MTRR antikoerper, mtrr antikoerper

Hintergrund: Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor.

Molekulargewicht: 80 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process