PNRC2 Antikörper (Middle Region)

Produktnummer ABIN632558

Produktdetails anti-PNRC2 Antikörper

Target: PNRC2 (Proline Rich Nuclear Receptor Coactivator 2 (PNRC2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNRC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PNRC2 antibody was raised against the middle region of PNRC2

Aufreinigung: Affinity purified

Immunogen: PNRC2 antibody was raised using the middle region of PNRC2 corresponding to a region with amino acids NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNRC2 Blocking Peptide, catalog no. 33R-6847, is also available for use as a blocking control in assays to test for specificity of this PNRC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNRC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNRC2

Target: PNRC2 (Proline Rich Nuclear Receptor Coactivator 2 (PNRC2))

Andere Bezeichnung: PNRC2 (PNRC2 Produkte)

Hintergrund: PNRC2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery.PNRC2 may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. PNRC2 is required for UPF1/RENT1 localization to the P-body. PNRC2 also acts as a nuclear receptor coactivator. PNRC2 may play a role in controlling the energy balance between energy storage and energy expenditure.

Molekulargewicht: 15 kDa (MW of target protein)