APOA2 Antikörper (N-Term)

Produktnummer ABIN632553

Produktdetails anti-APOA2 Antikörper

Target: APOA2 (Apolipoprotein A-II (APOA2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ApoA-II antibody was raised against the N terminal of APOA2

Aufreinigung: Affinity purified

Immunogen: ApoA-II antibody was raised using the N terminal of APOA2 corresponding to a region with amino acids MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ApoA-II Blocking Peptide, catalog no. 33R-6151, is also available for use as a blocking control in assays to test for specificity of this ApoA-II antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOA2

Target: APOA2 (Apolipoprotein A-II (APOA2))

Andere Bezeichnung: ApoA-II (APOA2 Produkte)

Synonyme: Apo-AII antikoerper, ApoA-II antikoerper, apoAII antikoerper, Alp-2 antikoerper, ApoAII antikoerper, Apoa-2 antikoerper, Hdl-1 antikoerper, APOAII antikoerper, apoa2 antikoerper, apoA-II antikoerper, cb1032 antikoerper, wu:fb57h11 antikoerper, zgc:193613 antikoerper, apolipoprotein A2 antikoerper, apolipoprotein A-II antikoerper, APOA2 antikoerper, Apoa2 antikoerper, apoa2 antikoerper

Hintergrund: This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.

Molekulargewicht: 9 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha, Production of Molecular Mediator of Immune Response, Negative Regulation of Transporter Activity, Lipid Metabolism