CHAC1 Antikörper

Produktnummer ABIN632509

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CHAC1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für CHAC1 Antikörper (ABIN632509)

Target: CHAC1 (ChaC, Cation Transport Regulator Homolog 1 (CHAC1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHAC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CHAC1 Antikörper

Aufreinigung: Affinity purified

Immunogen: CHAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHAC1 Blocking Peptide, (ABIN5612833), is also available for use as a blocking control in assays to test for specificity of this CHAC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHAC1

Target: CHAC1 (ChaC, Cation Transport Regulator Homolog 1 (CHAC1))

Andere Bezeichnung: CHAC1

Hintergrund: CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.

Molekulargewicht: 24 kDa (MW of target protein)