LGALS14 Antikörper (N-Term)

Produktnummer ABIN632507

Produktdetails anti-LGALS14 Antikörper

Target: LGALS14 (Lectin, Galactoside-Binding, Soluble, 14 (LGALS14))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LGALS14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LGALS14 antibody was raised against the N terminal of LGALS14

Aufreinigung: Affinity purified

Immunogen: LGALS14 antibody was raised using the N terminal of LGALS14 corresponding to a region with amino acids MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LGALS14 Blocking Peptide, catalog no. 33R-6502, is also available for use as a blocking control in assays to test for specificity of this LGALS14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LGALS14

Target: LGALS14 (Lectin, Galactoside-Binding, Soluble, 14 (LGALS14))

Andere Bezeichnung: LGALS14 (LGALS14 Produkte)

Synonyme: CLC2 antikoerper, PPL13 antikoerper, galectin 14 antikoerper, lectin, galactoside-binding, soluble, 14 antikoerper, galectin-14 antikoerper, LGALS14 antikoerper, LOC443162 antikoerper

Hintergrund: This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside.

Molekulargewicht: 16 kDa (MW of target protein)