COBLL1 Antikörper (Middle Region)

Produktnummer ABIN632504

Der Kaninchen Polyklonal Anti-COBLL1-Antikörper wurde für WB validiert. Er ist geeignet, COBLL1 in Proben von Human zu detektieren.

Kurzübersicht für COBLL1 Antikörper (Middle Region) (ABIN632504)

Target: COBLL1 (COBL-Like 1 (COBLL1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COBLL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-COBLL1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Cobl-Like 1 antibody was raised against the middle region of COBLL1

Aufreinigung: Affinity purified

Immunogen: Cobl-Like 1 antibody was raised using the middle region of COBLL1 corresponding to a region with amino acids QAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cobl-Like 1 Blocking Peptide, (ABIN5612945), is also available for use as a blocking control in assays to test for specificity of this Cobl-Like 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COBLL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COBLL1

Target: COBLL1 (COBL-Like 1 (COBLL1))

Andere Bezeichnung: Cobl-Like 1

Hintergrund: The function of COBLL1 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 128 kDa (MW of target protein)