COBLL1 Antikörper (N-Term)

Produktnummer ABIN632436

Produktdetails anti-COBLL1 Antikörper

Target: COBLL1 (COBL-Like 1 (COBLL1))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COBLL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Cobl-Like 1 antibody was raised against the N terminal of COBLL1

Aufreinigung: Affinity purified

Immunogen: Cobl-Like 1 antibody was raised using the N terminal of COBLL1 corresponding to a region with amino acids SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cobl-Like 1 Blocking Peptide, catalog no. 33R-8308, is also available for use as a blocking control in assays to test for specificity of this Cobl-Like 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COBLL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COBLL1

Target: COBLL1 (COBL-Like 1 (COBLL1))

Andere Bezeichnung: Cobl-Like 1 (COBLL1 Produkte)

Synonyme: DKFZp468N1516 antikoerper, 1810047P18Rik antikoerper, Coblr1 antikoerper, D430044D16Rik antikoerper, COBLR1 antikoerper, cordon-bleu WH2 repeat protein like 1 antikoerper, cordon-bleu protein-like 1 antikoerper, Cobl-like 1 antikoerper, cordon-bleu WH2 repeat protein-like 1 antikoerper, COBLL1 antikoerper, LOC100546808 antikoerper, Cobll1 antikoerper

Hintergrund: The function of this gene remains unknown.

Molekulargewicht: 128 kDa (MW of target protein)