ADH1B Antikörper

Produktnummer ABIN632493

Produktdetails anti-ADH1B Antikörper

Target: ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADH1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ADH1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADH1B Blocking Peptide, catalog no. 33R-8864, is also available for use as a blocking control in assays to test for specificity of this ADH1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADH1B

Target: ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))

Andere Bezeichnung: ADH1B (ADH1B Produkte)

Synonyme: AO090038000108 antikoerper, ADH antikoerper, Adh-2 antikoerper, Adh2 antikoerper, Dvir\\GJ18209 antikoerper, GJ18209 antikoerper, dvir_GLEANR_2772 antikoerper, ADH2 antikoerper, adh-2 antikoerper, adh2 antikoerper, alcohol dehydrogenase 2 antikoerper, Alcohol dehydrogenase 2 antikoerper, alcohol dehydrogenase 1B (class I), beta polypeptide antikoerper, alcohol dehydrogenase 1B (class I), beta polypeptide L homeolog antikoerper, CPR_0442 antikoerper, AOR_1_236174 antikoerper, AOR_1_178074 antikoerper, Dvir\Adh2 antikoerper, adhB antikoerper, ADH2 antikoerper, ADH1B antikoerper, adh1b.L antikoerper

Hintergrund: ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.

Molekulargewicht: 40 kDa (MW of target protein)