Chromosome 6 Open Reading Frame 134 (C6orf134) (N-Term) Antikörper

Produktnummer ABIN632487

Produktdetails

Target: Chromosome 6 Open Reading Frame 134 (C6orf134)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C6 orf134 antibody was raised against the N terminal of C6 rf134

Aufreinigung: Affinity purified

Immunogen: C6 orf134 antibody was raised using the N terminal of C6 rf134 corresponding to a region with amino acids MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C6orf134 Blocking Peptide, catalog no. 33R-5914, is also available for use as a blocking control in assays to test for specificity of this C6orf134 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf134 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Chromosome 6 Open Reading Frame 134 (C6orf134)

Andere Bezeichnung: C6orf134 (C6orf134 Produkte)

Synonyme: C6orf134 antikoerper, MEC17 antikoerper, Nbla00487 antikoerper, TAT antikoerper, mec17 antikoerper, wu:fj19c03 antikoerper, zgc:65893 antikoerper, zgc:77443 antikoerper, Alpha-TAT antikoerper, c6orf134 antikoerper, C23H6orf134 antikoerper, 0610011P08Rik antikoerper, 2610008K08Rik antikoerper, 2610110G12Rik antikoerper, 3110080J08Rik antikoerper, Mec17 antikoerper, RGD1303066 antikoerper, C7H6ORF134 antikoerper, C4H6orf134 antikoerper, alpha tubulin acetyltransferase 1 antikoerper, alpha tubulin acetyltransferase 1 S homeolog antikoerper, ATAT1 antikoerper, atat1 antikoerper, atat1.S antikoerper, Atat1 antikoerper

Hintergrund: The function of C6orf134 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 36 kDa (MW of target protein)