BEND7 Antikörper (Middle Region)

Produktnummer ABIN632454

Der Kaninchen Polyklonal anti-BEND7 Antikörper (ABIN632454) detektiert spezifisch BEND7 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für BEND7 Antikörper (Middle Region) (ABIN632454)

Target: BEND7 (BEN Domain Containing 7 (BEND7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BEND7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BEND7 Antikörper

Bindungsspezifität: Middle Region

Spezifität: BEND7 antibody was raised against the middle region of BEND7

Aufreinigung: Affinity purified

Immunogen: BEND7 antibody was raised using the middle region of BEND7 corresponding to a region with amino acids LGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BEND7 Blocking Peptide, (ABIN940357), is also available for use as a blocking control in assays to test for specificity of this BEND7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BEND7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BEND7

Target: BEND7 (BEN Domain Containing 7 (BEND7))

Andere Bezeichnung: BEND7

Hintergrund: The function of BEND protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 51 kDa (MW of target protein)