BEND7 Antikörper (N-Term)

Produktnummer ABIN632443

Produktdetails anti-BEND7 Antikörper

Target: BEND7 (BEN Domain Containing 7 (BEND7))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BEND7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C10 orf30 antibody was raised against the N terminal of C10 rf30

Aufreinigung: Affinity purified

Immunogen: C10 orf30 antibody was raised using the N terminal of C10 rf30 corresponding to a region with amino acids AGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C10orf30 Blocking Peptide, catalog no. 33R-1224, is also available for use as a blocking control in assays to test for specificity of this C10orf30 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BEND7

Target: BEND7 (BEN Domain Containing 7 (BEND7))

Andere Bezeichnung: C10orf30 (BEND7 Produkte)

Synonyme: C10orf30 antikoerper, 1110017O21Rik antikoerper, E130319B15Rik antikoerper, RGD1305898 antikoerper, BEN domain containing 7 antikoerper, si:ch211-220f12.4 antikoerper, BEND7 antikoerper, si:ch211-220f12.4 antikoerper, Bend7 antikoerper

Hintergrund: The function of Chromosome 10 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 51 kDa (MW of target protein)