Chromosome 6 Open Reading Frame 134 (C6orf134) (Middle Region) Antikörper
-
- Target Alle Chromosome 6 Open Reading Frame 134 (C6orf134) Antikörper anzeigen
- Chromosome 6 Open Reading Frame 134 (C6orf134)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C6 ORF134 antibody was raised against the middle region of C6 rf134
- Aufreinigung
- Affinity purified
- Immunogen
- C6 ORF134 antibody was raised using the middle region of C6 rf134 corresponding to a region with amino acids DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID
- Top Product
- Discover our top product C6orf134 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C6ORF134 Blocking Peptide, catalog no. 33R-1888, is also available for use as a blocking control in assays to test for specificity of this C6ORF134 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF134 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Chromosome 6 Open Reading Frame 134 (C6orf134)
- Andere Bezeichnung
- C6ORF134 (C6orf134 Produkte)
- Synonyme
- C6orf134 antikoerper, MEC17 antikoerper, Nbla00487 antikoerper, TAT antikoerper, mec17 antikoerper, wu:fj19c03 antikoerper, zgc:65893 antikoerper, zgc:77443 antikoerper, Alpha-TAT antikoerper, c6orf134 antikoerper, C23H6orf134 antikoerper, 0610011P08Rik antikoerper, 2610008K08Rik antikoerper, 2610110G12Rik antikoerper, 3110080J08Rik antikoerper, Mec17 antikoerper, RGD1303066 antikoerper, C7H6ORF134 antikoerper, C4H6orf134 antikoerper, alpha tubulin acetyltransferase 1 antikoerper, alpha tubulin acetyltransferase 1 S homeolog antikoerper, ATAT1 antikoerper, atat1 antikoerper, atat1.S antikoerper, Atat1 antikoerper
- Hintergrund
- The function of C6orf134 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 36 kDa (MW of target protein)
-