GSPT2 Antikörper (Middle Region)
-
- Target Alle GSPT2 Antikörper anzeigen
- GSPT2 (G1 To S Phase Transition 2 (GSPT2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GSPT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GSPT2 antibody was raised against the middle region of GSPT2
- Aufreinigung
- Affinity purified
- Immunogen
- GSPT2 antibody was raised using the middle region of GSPT2 corresponding to a region with amino acids GANIKEQSDFCPWYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYKDMGT
- Top Product
- Discover our top product GSPT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GSPT2 Blocking Peptide, catalog no. 33R-3163, is also available for use as a blocking control in assays to test for specificity of this GSPT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSPT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GSPT2 (G1 To S Phase Transition 2 (GSPT2))
- Andere Bezeichnung
- GSPT2 (GSPT2 Produkte)
- Hintergrund
- GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.
- Molekulargewicht
- 69 kDa (MW of target protein)
-