Lactate Dehydrogenase A Antikörper (Middle Region)
-
- Target Alle Lactate Dehydrogenase A (LDHA) Antikörper anzeigen
- Lactate Dehydrogenase A (LDHA)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Lactate Dehydrogenase A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LDHA antibody was raised against the middle region of LDHA
- Aufreinigung
- Affinity purified
- Immunogen
- LDHA antibody was raised using the middle region of LDHA corresponding to a region with amino acids PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH
- Top Product
- Discover our top product LDHA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LDHA Blocking Peptide, catalog no. 33R-7206, is also available for use as a blocking control in assays to test for specificity of this LDHA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Lactate Dehydrogenase A (LDHA)
- Andere Bezeichnung
- LDHA (LDHA Produkte)
- Synonyme
- GSD11 antikoerper, LDH1 antikoerper, LDHM antikoerper, LDH-M antikoerper, ldh-h antikoerper, ldha antikoerper, ldha-B antikoerper, ldhbb antikoerper, trg-5 antikoerper, Ldh1 antikoerper, Ldhm antikoerper, l7R2 antikoerper, gsd11 antikoerper, ldh-m antikoerper, ldh1 antikoerper, ldhm antikoerper, pig19 antikoerper, ldha1 antikoerper, ldhab antikoerper, LDH-A antikoerper, LDHC antikoerper, lactate dehydrogenase A antikoerper, lactate dehydrogenase B L homeolog antikoerper, lactate dehydrogenase A4 antikoerper, lactate dehydrogenase A L homeolog antikoerper, L-lactate dehydrogenase A chain antikoerper, LDHA antikoerper, ldhb.L antikoerper, Ldha antikoerper, ldha antikoerper, ldha.L antikoerper, LOC100713875 antikoerper
- Hintergrund
- LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Warburg Effekt
-