TPPP3 Antikörper (Middle Region)
-
- Target Alle TPPP3 Antikörper anzeigen
- TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TPPP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TPPP3 antibody was raised against the middle region of TPPP3
- Aufreinigung
- Affinity purified
- Immunogen
- TPPP3 antibody was raised using the middle region of TPPP3 corresponding to a region with amino acids PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD
- Top Product
- Discover our top product TPPP3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TPPP3 Blocking Peptide, catalog no. 33R-6969, is also available for use as a blocking control in assays to test for specificity of this TPPP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPPP3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))
- Andere Bezeichnung
- TPPP3 (TPPP3 Produkte)
- Synonyme
- p20 antikoerper, p25gamma antikoerper, 2700055K07Rik antikoerper, CGI-38 antikoerper, Ceacam9 antikoerper, mmCGM8 antikoerper, RGD1305061 antikoerper, tubulin polymerization promoting protein family member 3 antikoerper, tubulin polymerization-promoting protein family member 3 antikoerper, tubulin polymerization-promoting protein family member 3 L homeolog antikoerper, TPPP3 antikoerper, Tppp3 antikoerper, tppp3.L antikoerper
- Hintergrund
- TPPP3 belongs to the TPPP family. This protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. The function of TPPP3 remains unknown.
- Molekulargewicht
- 19 kDa (MW of target protein)
-