TPPP3 Antikörper (N-Term)

Produktnummer ABIN632414

Der Kaninchen Polyklonal Anti-TPPP3-Antikörper wurde für WB validiert. Er ist geeignet, TPPP3 in Proben von Human zu detektieren.

Kurzübersicht für TPPP3 Antikörper (N-Term) (ABIN632414)

Target: TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPPP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TPPP3 Antikörper

Bindungsspezifität: N-Term

Spezifität: TPPP3 antibody was raised against the N terminal of TPPP3

Aufreinigung: Affinity purified

Immunogen: TPPP3 antibody was raised using the N terminal of TPPP3 corresponding to a region with amino acids MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TPPP3 Blocking Peptide, (ABIN5616742), is also available for use as a blocking control in assays to test for specificity of this TPPP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPPP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TPPP3

Target: TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))

Andere Bezeichnung: TPPP3

Hintergrund: TPPP3 belongs to the TPPP family. This protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. The function of TPPP3 remains unknown.

Molekulargewicht: 19 kDa (MW of target protein)