EXOC5 Antikörper (N-Term)

Produktnummer ABIN632393

Der Kaninchen Polyklonal Anti-EXOC5-Antikörper wurde für WB validiert. Er ist geeignet, EXOC5 in Proben von Human zu detektieren.

Kurzübersicht für EXOC5 Antikörper (N-Term) (ABIN632393)

Target: EXOC5 (Exocyst Complex Component 5 (EXOC5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EXOC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EXOC5 Antikörper

Bindungsspezifität: N-Term

Spezifität: EXOC5 antibody was raised against the N terminal of EXOC5

Aufreinigung: Affinity purified

Immunogen: EXOC5 antibody was raised using the N terminal of EXOC5 corresponding to a region with amino acids ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXOC5 Blocking Peptide, catalog no. 33R-1562, is also available for use as a blocking control in assays to test for specificity of this EXOC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EXOC5

Target: EXOC5 (Exocyst Complex Component 5 (EXOC5))

Andere Bezeichnung: EXOC5

Hintergrund: The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.

Molekulargewicht: 82 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis