EXOC6 Antikörper (N-Term)

Produktnummer ABIN632342

Der Kaninchen Polyklonal Anti-EXOC6-Antikörper wurde für WB validiert. Er ist geeignet, EXOC6 in Proben von Human zu detektieren.

Kurzübersicht für EXOC6 Antikörper (N-Term) (ABIN632342)

Target: EXOC6 (Exocyst Complex Component 6 (EXOC6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EXOC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EXOC6 Antikörper

Bindungsspezifität: N-Term

Spezifität: EXOC6 antibody was raised against the N terminal of EXOC6

Aufreinigung: Affinity purified

Immunogen: EXOC6 antibody was raised using the N terminal of EXOC6 corresponding to a region with amino acids MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXOC6 Blocking Peptide, (ABIN5613429), is also available for use as a blocking control in assays to test for specificity of this EXOC6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EXOC6

Target: EXOC6 (Exocyst Complex Component 6 (EXOC6))

Andere Bezeichnung: EXOC6

Hintergrund: The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molekulargewicht: 88 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis