FAS Antikörper

Produktnummer ABIN632316

Der Kaninchen Polyklonal anti-FAS Antikörper (ABIN632316) detektiert spezifisch FAS in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für FAS Antikörper (ABIN632316)

Target: FAS (TNF Receptor Superfamily, Member 6 (FAS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAS Antikörper

Aufreinigung: Affinity purified

Immunogen: FAS antibody was raised using a synthetic peptide corresponding to a region with amino acids KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAS Blocking Peptide, (ABIN939841), is also available for use as a blocking control in assays to test for specificity of this FAS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAS

Target: FAS (TNF Receptor Superfamily, Member 6 (FAS))

Andere Bezeichnung: FAS

Hintergrund: FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: p53 Signalweg, Apoptose, Production of Molecular Mediator of Immune Response, Positive Regulation of Endopeptidase Activity