Esterase D Antikörper (N-Term)
-
- Target Alle Esterase D (ESD) Antikörper anzeigen
- Esterase D (ESD)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Esterase D Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ESD antibody was raised against the N terminal of ESD
- Aufreinigung
- Affinity purified
- Immunogen
- ESD antibody was raised using the N terminal of ESD corresponding to a region with amino acids MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW
- Top Product
- Discover our top product ESD Primärantikörper
-
anti-Esterase D (ESD) antibody
ESD Reaktivität: Human, Maus, Ratte WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Esterase D (ESD) antibodyESD Reaktivität: Human, Maus WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Esterase D (ESD) (AA 183-281) antibodyESD Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1E1 unconjugated
anti-Esterase D (ESD) (AA 68-102) antibodyESD Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal RB47739 unconjugated
anti-Esterase D (ESD) (AA 1-282) antibodyESD Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Esterase D (ESD) (AA 2-282) antibodyESD Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Esterase D (ESD) (AA 1-282) antibodyESD Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Esterase D (ESD) (N-Term) antibodyESD Reaktivität: Human, Schwein, Rind (Kuh), Hund, Pferd, Affe, Fledermaus, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-Esterase D (ESD) (N-Term) antibodyESD Reaktivität: Human, Maus, Ratte, Schwein, Rind (Kuh), Hund, Pferd, Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ESD Blocking Peptide, catalog no. 33R-5690, is also available for use as a blocking control in assays to test for specificity of this ESD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Esterase D (ESD)
- Andere Bezeichnung
- ESD (ESD Produkte)
- Synonyme
- FGH antikoerper, Es-10 antikoerper, Es10 antikoerper, sid478 antikoerper, wu:fb58f05 antikoerper, zgc:111984 antikoerper, ARABIDOPSIS THALIANA S-FORMYLGLUTATHIONE HYDROLASE antikoerper, ATSFGH antikoerper, S-formylglutathione hydrolase antikoerper, T32G6.5 antikoerper, T32G6_5 antikoerper, esterase D antikoerper, esterase D/formylglutathione hydrolase antikoerper, S-formylglutathione hydrolase antikoerper, esterase D L homeolog antikoerper, ESD antikoerper, Esd antikoerper, esd antikoerper, SFGH antikoerper, esd.L antikoerper, NMA1519 antikoerper, LOC100282053 antikoerper
- Hintergrund
- ESD is a serine hydrolase involved in the detoxification of formaldehyde.
- Molekulargewicht
- 31 kDa (MW of target protein)
-
