Esterase D Antikörper (N-Term)

Produktnummer ABIN632304

Dieses Anti-Esterase D-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Esterase D in WB. Geeignet für Human.

Kurzübersicht für Esterase D Antikörper (N-Term) (ABIN632304)

Target: Esterase D (ESD)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Esterase D Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Esterase D Antikörper

Bindungsspezifität: N-Term

Spezifität: ESD antibody was raised against the N terminal of ESD

Aufreinigung: Affinity purified

Immunogen: ESD antibody was raised using the N terminal of ESD corresponding to a region with amino acids MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ESD Blocking Peptide, (ABIN5613402), is also available for use as a blocking control in assays to test for specificity of this ESD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Esterase D

Target: Esterase D (ESD)

Andere Bezeichnung: ESD

Hintergrund: ESD is a serine hydrolase involved in the detoxification of formaldehyde.

Molekulargewicht: 31 kDa (MW of target protein)