ALKBH3 Antikörper

Produktnummer ABIN632277

Dieser Anti-ALKBH3 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von ALKBH3 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ALKBH3 Antikörper (ABIN632277)

Target: ALKBH3 (AlkB, Alkylation Repair Homolog 3 (ALKBH3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALKBH3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALKBH3 Antikörper

Aufreinigung: Affinity purified

Immunogen: ALKBH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALKBH3 Blocking Peptide, (ABIN937979), is also available for use as a blocking control in assays to test for specificity of this ALKBH3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALKBH3

Target: ALKBH3 (AlkB, Alkylation Repair Homolog 3 (ALKBH3))

Andere Bezeichnung: ALKBH3

Hintergrund: The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: DNA Reparatur