PEX7 Antikörper (N-Term)

Produktnummer ABIN632262

Dieses Anti-PEX7-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PEX7 in WB. Geeignet für Maus und Human.

Kurzübersicht für PEX7 Antikörper (N-Term) (ABIN632262)

Target: PEX7 (Peroxisomal Biogenesis Factor 7 (PEX7))

Reaktivität: Maus, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PEX7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PEX7 Antikörper

Bindungsspezifität: N-Term

Spezifität: PEX7 antibody was raised against the N terminal of PEX7

Aufreinigung: Affinity purified

Immunogen: PEX7 antibody was raised using the N terminal of PEX7 corresponding to a region with amino acids MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PEX7 Blocking Peptide, (ABIN5615320), is also available for use as a blocking control in assays to test for specificity of this PEX7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PEX7

Target: PEX7 (Peroxisomal Biogenesis Factor 7 (PEX7))

Andere Bezeichnung: PEX7

Hintergrund: PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process