CSNK1G3 Antikörper (Middle Region)
-
- Target Alle CSNK1G3 Antikörper anzeigen
- CSNK1G3 (Casein Kinase 1, gamma 3 (CSNK1G3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CSNK1G3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CK1 gamma 3 antibody was raised against the middle region of CSNK1 G3
- Aufreinigung
- Affinity purified
- Immunogen
- CK1 gamma 3 antibody was raised using the middle region of CSNK1 G3 corresponding to a region with amino acids LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP
- Top Product
- Discover our top product CSNK1G3 Primärantikörper
-
anti-Casein Kinase 1, gamma 3 (CSNK1G3) (AA 333-361), (C-Term) antibody
CSNK1G3 Reaktivität: Maus WB, IHC (p), FACS Wirt: Kaninchen Polyclonal RB34464 unconjugated
anti-Casein Kinase 1, gamma 3 (CSNK1G3) (N-Term) antibodyCSNK1G3 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Casein Kinase 1, gamma 3 (CSNK1G3) (AA 1-204), (Isoform gamma 3) antibodyCSNK1G3 Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Casein Kinase 1, gamma 3 (CSNK1G3) antibodyCSNK1G3 Reaktivität: Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-Casein Kinase 1, gamma 3 (CSNK1G3) (AA 304-423) antibodyCSNK1G3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Casein Kinase 1, gamma 3 (CSNK1G3) (AA 232-281) antibodyCSNK1G3 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Affe, Kaninchen, Zebrafisch (Danio rerio), Hund, Meerschweinchen, Pferd, Xenopus laevis, Fledermaus, Drosophila melanogaster, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Casein Kinase 1, gamma 3 (CSNK1G3) (AA 350-381), (C-Term) antibodyCSNK1G3 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Casein Kinase 1, gamma 3 (CSNK1G3) (C-Term) antibodyCSNK1G3 Reaktivität: Human WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Casein Kinase 1, gamma 3 (CSNK1G3) antibodyCSNK1G3 Reaktivität: Maus WB, IHC, FACS Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CK1 gamma 3 Blocking Peptide, catalog no. 33R-4875, is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSNK1G3 (Casein Kinase 1, gamma 3 (CSNK1G3))
- Andere Bezeichnung
- CK1 gamma 3 (CSNK1G3 Produkte)
- Synonyme
- CKI-gamma 3 antikoerper, CSNK1G3L antikoerper, 3300002K07Rik antikoerper, C330049O21Rik antikoerper, casein kinase 1 gamma 3 antikoerper, casein kinase 1 gamma 3 L homeolog antikoerper, casein kinase 1, gamma 3 antikoerper, CSNK1G3 antikoerper, csnk1g3 antikoerper, csnk1g3.L antikoerper, Csnk1g3 antikoerper
- Hintergrund
- Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1G3 can phosphorylate a large number of proteins. It participates in Wnt signaling.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- Hedgehog Signalweg
-
