Casein Kinase 1 gamma 2 Antikörper (Middle Region)

Produktnummer ABIN632231

Der Kaninchen Polyklonal Anti-Casein Kinase 1 gamma 2-Antikörper wurde für WB validiert. Er ist geeignet, Casein Kinase 1 gamma 2 in Proben von Human zu detektieren.

Kurzübersicht für Casein Kinase 1 gamma 2 Antikörper (Middle Region) (ABIN632231)

Target: Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Casein Kinase 1 gamma 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Casein Kinase 1 gamma 2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CK1 gamma 2 antibody was raised against the middle region of CSNK1 G2

Aufreinigung: Affinity purified

Immunogen: CK1 gamma 2 antibody was raised using the middle region of CSNK1 G2 corresponding to a region with amino acids SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CK1 gamma 2 Blocking Peptide, (ABIN5612899), is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Casein Kinase 1 gamma 2

Target: Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))

Hintergrund: CSNK1G2 belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family, casein kinase I subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. It participates in Wnt signaling.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Hedgehog Signalweg