Casein Kinase 1 gamma 2 Antikörper (Middle Region)
-
- Target Alle Casein Kinase 1 gamma 2 (CSNK1G2) Antikörper anzeigen
- Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Casein Kinase 1 gamma 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CK1 gamma 2 antibody was raised against the middle region of CSNK1 G2
- Aufreinigung
- Affinity purified
- Immunogen
- CK1 gamma 2 antibody was raised using the middle region of CSNK1 G2 corresponding to a region with amino acids SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR
- Top Product
- Discover our top product CSNK1G2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CK1 gamma 2 Blocking Peptide, catalog no. 33R-8561, is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))
- Abstract
- CSNK1G2 Produkte
- Hintergrund
- CSNK1G2 belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family, casein kinase I subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. It participates in Wnt signaling.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Hedgehog Signalweg
-