GTR2 Antikörper (N-Term)
-
- Target Alle GTR2 (RRAGC) Antikörper anzeigen
- GTR2 (RRAGC) (Ras-Related GTP Binding C (RRAGC))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GTR2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RRAGC antibody was raised against the N terminal of RRAGC
- Aufreinigung
- Affinity purified
- Immunogen
- RRAGC antibody was raised using the N terminal of RRAGC corresponding to a region with amino acids RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ
- Top Product
- Discover our top product RRAGC Primärantikörper
-
anti-Ras-Related GTP Binding C (RRAGC) antibody
RRAGC Reaktivität: Human, Maus, Ratte IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Ras-Related GTP Binding C (RRAGC) (AA 1-250) antibodyRRAGC Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ras-Related GTP Binding C (RRAGC) (full length) antibodyRRAGC Reaktivität: Human, Maus, Hamster WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Ras-Related GTP Binding C (RRAGC) (AA 301-399) antibodyRRAGC Reaktivität: Human ELISA, IF (cc), IF (p), IHC (p), IHC (fro), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Ras-Related GTP Binding C (RRAGC) (AA 169-198) antibodyRRAGC Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB33068 unconjugated
anti-Ras-Related GTP Binding C (RRAGC) (AA 1-399) antibodyRRAGC Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Ras-Related GTP Binding C (RRAGC) (C-Term) antibodyRRAGC Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Ras-Related GTP Binding C (RRAGC) (C-Term) antibodyRRAGC Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Ras-Related GTP Binding C (RRAGC) antibodyRRAGC Reaktivität: Human, Maus WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Ras-Related GTP Binding C (RRAGC) (Internal Region) antibodyRRAGC Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RRAGC Blocking Peptide, catalog no. 33R-8180, is also available for use as a blocking control in assays to test for specificity of this RRAGC antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRAGC antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GTR2 (RRAGC) (Ras-Related GTP Binding C (RRAGC))
- Andere Bezeichnung
- RRAGC (RRAGC Produkte)
- Synonyme
- GTR2 antikoerper, RAGC antikoerper, TIB929 antikoerper, AU041672 antikoerper, Gtr2 antikoerper, YGR163W antikoerper, RRAGC antikoerper, gtr2 antikoerper, ragc antikoerper, rragc antikoerper, zgc:111971 antikoerper, Ras related GTP binding C antikoerper, Ras-related GTP binding C antikoerper, Ras related GTP binding C S homeolog antikoerper, Ras-related GTP binding Ca antikoerper, RRAGC antikoerper, Rragc antikoerper, rragc.S antikoerper, rragc antikoerper, rragca antikoerper
- Hintergrund
- RRAGC is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Autophagie
-
