GTR2 Antikörper (N-Term)

Produktnummer ABIN632203

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch GTR2 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für GTR2 Antikörper (N-Term) (ABIN632203)

Target: GTR2 (RRAGC) (Ras-Related GTP Binding C (RRAGC))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GTR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GTR2 Antikörper

Bindungsspezifität: N-Term

Spezifität: RRAGC antibody was raised against the N terminal of RRAGC

Aufreinigung: Affinity purified

Immunogen: RRAGC antibody was raised using the N terminal of RRAGC corresponding to a region with amino acids RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RRAGC Blocking Peptide, (ABIN5615960), is also available for use as a blocking control in assays to test for specificity of this RRAGC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRAGC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GTR2

Target: GTR2 (RRAGC) (Ras-Related GTP Binding C (RRAGC))

Andere Bezeichnung: RRAGC

Hintergrund: RRAGC is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Autophagie