FGFR1OP Antikörper (Middle Region)

Produktnummer ABIN632197

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch FGFR1OP in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für FGFR1OP Antikörper (Middle Region) (ABIN632197)

Target: FGFR1OP (FGFR1 Oncogene Partner (FGFR1OP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FGFR1OP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FGFR1OP Antikörper

Bindungsspezifität: Middle Region

Spezifität: FGFR1 OP antibody was raised against the middle region of FGFR1 P

Aufreinigung: Affinity purified

Immunogen: FGFR1 OP antibody was raised using the middle region of FGFR1 P corresponding to a region with amino acids LSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEAN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FGFR1OP Blocking Peptide, (ABIN5613578), is also available for use as a blocking control in assays to test for specificity of this FGFR1OP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGFR0 P antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FGFR1OP

Target: FGFR1OP (FGFR1 Oncogene Partner (FGFR1OP))

Andere Bezeichnung: FGFR1OP

Hintergrund: FGFR1OP is a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t (6,8)(q27,p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: M Phase, Maintenance of Protein Location, SARS-CoV-2 Protein Interaktom