COPS4 Antikörper
-
- Target Alle COPS4 Antikörper anzeigen
- COPS4 (COP9 Signalosome Subunit 4 (COPS4))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser COPS4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- COPS4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYA
- Top Product
- Discover our top product COPS4 Primärantikörper
-
anti-COP9 Signalosome Subunit 4 (COPS4) (AA 1-310) antibody
COPS4 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-COP9 Signalosome Subunit 4 (COPS4) (AA 53-102) antibodyCOPS4 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Kaninchen, Meerschweinchen, Schwein, Fledermaus, Hamster, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-COP9 Signalosome Subunit 4 (COPS4) (AA 143-192) antibodyCOPS4 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Kaninchen, Meerschweinchen, Schwein, Zebrafisch (Danio rerio), Huhn, Fledermaus, Hamster, Affe, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-COP9 Signalosome Subunit 4 (COPS4) (Middle Region) antibodyCOPS4 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Kaninchen, Meerschweinchen, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
COPS4 Blocking Peptide, catalog no. 33R-10150, is also available for use as a blocking control in assays to test for specificity of this COPS4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPS4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COPS4 (COP9 Signalosome Subunit 4 (COPS4))
- Andere Bezeichnung
- COPS4 (COPS4 Produkte)
- Hintergrund
- COPS4 is one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases.
- Molekulargewicht
- 46 kDa (MW of target protein)
- Pathways
- Zellzyklus
-
