COPS4 Antikörper

Produktnummer ABIN632182

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch COPS4 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für COPS4 Antikörper (ABIN632182)

Target: COPS4 (COP9 Signalosome Subunit 4 (COPS4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COPS4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-COPS4 Antikörper

Aufreinigung: Affinity purified

Immunogen: COPS4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COPS4 Blocking Peptide, (ABIN936117), is also available for use as a blocking control in assays to test for specificity of this COPS4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPS4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COPS4

Target: COPS4 (COP9 Signalosome Subunit 4 (COPS4))

Andere Bezeichnung: COPS4

Hintergrund: COPS4 is one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Zellzyklus