EIF3E Antikörper (N-Term)

Produktnummer ABIN632164

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch EIF3E in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für EIF3E Antikörper (N-Term) (ABIN632164)

Target: EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF3E Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EIF3E Antikörper

Bindungsspezifität: N-Term

Spezifität: EIF3 E antibody was raised against the N terminal of EIF3

Aufreinigung: Affinity purified

Immunogen: EIF3 E antibody was raised using the N terminal of EIF3 corresponding to a region with amino acids ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF3E Blocking Peptide, (ABIN937943), is also available for use as a blocking control in assays to test for specificity of this EIF3E antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF3E

Target: EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))

Andere Bezeichnung: EIF3E

Hintergrund: EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD), It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Hepatitis C