SFRP2 Antikörper (Middle Region)

Produktnummer ABIN632136

Der Kaninchen Polyklonal anti-SFRP2 Antikörper (ABIN632136) detektiert spezifisch SFRP2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Hund.

Kurzübersicht für SFRP2 Antikörper (Middle Region) (ABIN632136)

Target: SFRP2 (Secreted Frizzled-Related Protein 2 (SFRP2))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFRP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SFRP2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SFRP2 antibody was raised against the middle region of SFRP2

Aufreinigung: Affinity purified

Immunogen: SFRP2 antibody was raised using the middle region of SFRP2 corresponding to a region with amino acids DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRP2 Blocking Peptide, (ABIN937528), is also available for use as a blocking control in assays to test for specificity of this SFRP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFRP2

Target: SFRP2 (Secreted Frizzled-Related Protein 2 (SFRP2))

Andere Bezeichnung: SFRP2

Hintergrund: SFRP2 is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.

Molekulargewicht: 31 kDa (MW of target protein)

Pathways: WNT Signalweg, Tube Formation, Positive Regulation of Endopeptidase Activity, Negative Regulation of intrinsic apoptotic Signaling, Positive Regulation of fat Cell Differentiation