IMPA1 Antikörper (Middle Region)

Produktnummer ABIN632122

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch IMPA1 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für IMPA1 Antikörper (Middle Region) (ABIN632122)

Target: IMPA1 (Inositol(myo)-1(or 4)-Monophosphatase 1 (IMPA1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IMPA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IMPA1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: IMPA1 antibody was raised against the middle region of IMPA1

Aufreinigung: Affinity purified

Immunogen: IMPA1 antibody was raised using the middle region of IMPA1 corresponding to a region with amino acids IVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IMPA1 Blocking Peptide, (ABIN939595), is also available for use as a blocking control in assays to test for specificity of this IMPA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IMPA1

Target: IMPA1 (Inositol(myo)-1(or 4)-Monophosphatase 1 (IMPA1))

Andere Bezeichnung: IMPA1

Hintergrund: IMPA1 is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. IMPA1 can use myo-inositol monophosphates, myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates.

Molekulargewicht: 30 kDa (MW of target protein)