IMPA1 Antikörper (Middle Region)
-
- Target Alle IMPA1 Antikörper anzeigen
- IMPA1 (Inositol(myo)-1(or 4)-Monophosphatase 1 (IMPA1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IMPA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IMPA1 antibody was raised against the middle region of IMPA1
- Aufreinigung
- Affinity purified
- Immunogen
- IMPA1 antibody was raised using the middle region of IMPA1 corresponding to a region with amino acids IVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
- Top Product
- Discover our top product IMPA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IMPA1 Blocking Peptide, catalog no. 33R-4209, is also available for use as a blocking control in assays to test for specificity of this IMPA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IMPA1 (Inositol(myo)-1(or 4)-Monophosphatase 1 (IMPA1))
- Andere Bezeichnung
- IMPA1 (IMPA1 Produkte)
- Synonyme
- zgc:100926 antikoerper, 2610002K09Rik antikoerper, 2900059K10Rik antikoerper, AI325909 antikoerper, IMP antikoerper, IMPA antikoerper, impa antikoerper, inositol monophosphatase 1 antikoerper, inositol(myo)-1(or 4)-monophosphatase 1 antikoerper, inositol (myo)-1(or 4)-monophosphatase 1 antikoerper, inositol monophosphatase antikoerper, inositol(myo)-1(or 4)-monophosphatase 1 S homeolog antikoerper, impa1 antikoerper, Impa1 antikoerper, IMPA1 antikoerper, impa1.S antikoerper
- Hintergrund
- IMPA1 is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. IMPA1 can use myo-inositol monophosphates, myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates.
- Molekulargewicht
- 30 kDa (MW of target protein)
-