DCAF12 Antikörper (Middle Region)
-
- Target Alle DCAF12 Antikörper anzeigen
- DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DCAF12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WDR40 A antibody was raised against the middle region of WDR40
- Aufreinigung
- Affinity purified
- Immunogen
- WDR40 A antibody was raised using the middle region of WDR40 corresponding to a region with amino acids TKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKEL
- Top Product
- Discover our top product DCAF12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WDR40A Blocking Peptide, catalog no. 33R-9149, is also available for use as a blocking control in assays to test for specificity of this WDR40A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR40 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))
- Andere Bezeichnung
- WDR40A (DCAF12 Produkte)
- Synonyme
- CT102 antikoerper, KIAA1892 antikoerper, TCC52 antikoerper, WDR40A antikoerper, 1500001L20Rik antikoerper, 5830424K06Rik antikoerper, AA420338 antikoerper, AI851081 antikoerper, Wdr40a antikoerper, wdr40a antikoerper, wu:fb93d04 antikoerper, zgc:154031 antikoerper, wdr40b antikoerper, dcaf12 antikoerper, wdr40a-a antikoerper, DDB1 and CUL4 associated factor 12 antikoerper, DDB1 and CUL4 associated factor 12 L homeolog antikoerper, DCAF12 antikoerper, Dcaf12 antikoerper, dcaf12 antikoerper, dcaf12.L antikoerper
- Hintergrund
- This gene was identified by isolating cDNA from a size-fractionated library derived from brain in an attempt to characterize genes encoding large proteins. The function of the protein encoded by this gene has not yet been determined.
- Molekulargewicht
- 50 kDa (MW of target protein)
-