DCAF12 Antikörper (N-Term)

Produktnummer ABIN631786

Produktdetails anti-DCAF12 Antikörper

Target: DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCAF12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDR40 A antibody was raised against the N terminal of WDR40

Aufreinigung: Affinity purified

Immunogen: WDR40 A antibody was raised using the N terminal of WDR40 corresponding to a region with amino acids ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR40A Blocking Peptide, catalog no. 33R-1481, is also available for use as a blocking control in assays to test for specificity of this WDR40A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCAF12

Target: DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))

Andere Bezeichnung: WDR40A (DCAF12 Produkte)

Synonyme: CT102 antikoerper, KIAA1892 antikoerper, TCC52 antikoerper, WDR40A antikoerper, 1500001L20Rik antikoerper, 5830424K06Rik antikoerper, AA420338 antikoerper, AI851081 antikoerper, Wdr40a antikoerper, wdr40a antikoerper, wu:fb93d04 antikoerper, zgc:154031 antikoerper, wdr40b antikoerper, dcaf12 antikoerper, wdr40a-a antikoerper, DDB1 and CUL4 associated factor 12 antikoerper, DDB1 and CUL4 associated factor 12 L homeolog antikoerper, DCAF12 antikoerper, Dcaf12 antikoerper, dcaf12 antikoerper, dcaf12.L antikoerper

Hintergrund: WDR40A is believed to be involved in protein binding.

Molekulargewicht: 50 kDa (MW of target protein)