PPM1J Antikörper
-
- Target Alle PPM1J Antikörper anzeigen
- PPM1J (Protein Phosphatase 1J (PPM1J))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPM1J Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PPM1 J antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE
- Top Product
- Discover our top product PPM1J Primärantikörper
-
anti-Protein Phosphatase 1J (PPM1J) (AA 1-505) antibody
PPM1J Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1J (PPM1J) (AA 294-505) antibodyPPM1J Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1J (PPM1J) antibodyPPM1J Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1J (PPM1J) (AA 133-442) antibodyPPM1J Reaktivität: Human WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1J (PPM1J) antibodyPPM1J Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1J (PPM1J) (AA 1-505) antibodyPPM1J Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Protein Phosphatase 1J (PPM1J) (C-Term) antibodyPPM1J Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Affe, Schwein, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1J (PPM1J) (AA 130-260) antibodyPPM1J Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1J (PPM1J) (AA 71-120) antibodyPPM1J Reaktivität: Human, Maus, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPM1J Blocking Peptide, catalog no. 33R-9070, is also available for use as a blocking control in assays to test for specificity of this PPM1J antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPM1J (Protein Phosphatase 1J (PPM1J))
- Andere Bezeichnung
- PPM1J (PPM1J Produkte)
- Hintergrund
- PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known.
- Molekulargewicht
- 55 kDa (MW of target protein)
-
