PPM1J Antikörper

Produktnummer ABIN632095

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PPM1J in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für PPM1J Antikörper (ABIN632095)

Target: PPM1J (Protein Phosphatase 1J (PPM1J))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPM1J Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PPM1J Antikörper

Aufreinigung: Affinity purified

Immunogen: PPM1 J antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPM1J Blocking Peptide, (ABIN5615499), is also available for use as a blocking control in assays to test for specificity of this PPM1J antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPM1J

Target: PPM1J (Protein Phosphatase 1J (PPM1J))

Andere Bezeichnung: PPM1J

Hintergrund: PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known.

Molekulargewicht: 55 kDa (MW of target protein)