MAP3K14 Antikörper (N-Term)

Produktnummer ABIN632058

Produktdetails anti-MAP3K14 Antikörper

Target: MAP3K14 (Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAP3K14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAP3 K14 antibody was raised against the N terminal of MAP3 14

Aufreinigung: Affinity purified

Immunogen: MAP3 K14 antibody was raised using the N terminal of MAP3 14 corresponding to a region with amino acids SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAP3K14 Blocking Peptide, catalog no. 33R-8382, is also available for use as a blocking control in assays to test for specificity of this MAP3K14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAP3K14

Target: MAP3K14 (Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14))

Andere Bezeichnung: MAP3K14 (MAP3K14 Produkte)

Synonyme: FTDCR1B antikoerper, HS antikoerper, HSNIK antikoerper, NIK antikoerper, F23F1.4 antikoerper, F23F1_4 antikoerper, mitogen-activated protein kinase kinase kinase 14 antikoerper, Nik antikoerper, aly antikoerper, mitogen-activated protein kinase kinase kinase 14 antikoerper, MAP3K14 antikoerper, Map3k14 antikoerper, MAPKKK14 antikoerper

Hintergrund: This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.

Molekulargewicht: 104 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg, T-Zell Rezeptor Signalweg