MAP3K14 Antikörper (N-Term)
-
- Target Alle MAP3K14 Antikörper anzeigen
- MAP3K14 (Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAP3K14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAP3 K14 antibody was raised against the N terminal of MAP3 14
- Aufreinigung
- Affinity purified
- Immunogen
- MAP3 K14 antibody was raised using the N terminal of MAP3 14 corresponding to a region with amino acids SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
- Top Product
- Discover our top product MAP3K14 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAP3K14 Blocking Peptide, catalog no. 33R-8382, is also available for use as a blocking control in assays to test for specificity of this MAP3K14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAP3K14 (Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14))
- Andere Bezeichnung
- MAP3K14 (MAP3K14 Produkte)
- Hintergrund
- This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.
- Molekulargewicht
- 104 kDa (MW of target protein)
- Pathways
- NF-kappaB Signalweg, T-Zell Rezeptor Signalweg
-