AGO1 Antikörper (N-Term)

Produktnummer ABIN632044

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch AGO1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für AGO1 Antikörper (N-Term) (ABIN632044)

Target: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AGO1 Antikörper

Bindungsspezifität: N-Term

Spezifität: EIF2 C1 antibody was raised against the N terminal of EIF2 1

Aufreinigung: Affinity purified

Immunogen: EIF2 C1 antibody was raised using the N terminal of EIF2 1 corresponding to a region with amino acids MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF2C1 Blocking Peptide, (ABIN5613323), is also available for use as a blocking control in assays to test for specificity of this EIF2C1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AGO1

Target: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Andere Bezeichnung: EIF2C1

Hintergrund: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain.

Molekulargewicht: 97 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, Regulatorische RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Hormone Transport, Regulation of Actin Filament Polymerization, Stem Cell Maintenance, Ribonucleoprotein Complex Subunit Organization