Pellino 1 Antikörper

Produktnummer ABIN632023

Produktdetails anti-Pellino 1 Antikörper

Target: Pellino 1 (PELI1) (Pellino E3 Ubiquitin Protein Ligase 1 (PELI1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Pellino 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PELI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PELI1 Blocking Peptide, catalog no. 33R-2740, is also available for use as a blocking control in assays to test for specificity of this PELI1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PELI1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Pellino 1

Target: Pellino 1 (PELI1) (Pellino E3 Ubiquitin Protein Ligase 1 (PELI1))

Andere Bezeichnung: PELI1 (PELI1 Produkte)

Synonyme: 2810468L03Rik antikoerper, A930031K15Rik antikoerper, AA409794 antikoerper, AI586297 antikoerper, D11Ertd676e antikoerper, peli1 antikoerper, peli1.L antikoerper, pellino1 antikoerper, xpellino1 antikoerper, wu:fd12d01 antikoerper, zgc:153297 antikoerper, pellino E3 ubiquitin protein ligase 1 antikoerper, pellino 1 antikoerper, pellino E3 ubiquitin protein ligase 1 S homeolog antikoerper, pellino E3 ubiquitin protein ligase 1b antikoerper, PELI1 antikoerper, Peli1 antikoerper, peli1.S antikoerper, peli1b antikoerper

Hintergrund: PELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades