Pellino 1 Antikörper

Produktnummer ABIN632023

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Pellino 1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Pellino 1 Antikörper (ABIN632023)

Target: Pellino 1 (PELI1) (Pellino E3 Ubiquitin Protein Ligase 1 (PELI1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Pellino 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Pellino 1 Antikörper

Aufreinigung: Affinity purified

Immunogen: PELI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PELI1 Blocking Peptide, catalog no. 33R-2740, is also available for use as a blocking control in assays to test for specificity of this PELI1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PELI1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Pellino 1

Target: Pellino 1 (PELI1) (Pellino E3 Ubiquitin Protein Ligase 1 (PELI1))

Andere Bezeichnung: PELI1

Hintergrund: PELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades