RIPK4 Antikörper (N-Term)

Produktnummer ABIN632015

Produktdetails anti-RIPK4 Antikörper

Target: RIPK4 (Receptor-Interacting Serine-threonine Kinase 4 (RIPK4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RIPK4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RIPK4 antibody was raised against the N terminal of RIPK4

Aufreinigung: Affinity purified

Immunogen: RIPK4 antibody was raised using the N terminal of RIPK4 corresponding to a region with amino acids DGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RIPK4 Blocking Peptide, catalog no. 33R-1956, is also available for use as a blocking control in assays to test for specificity of this RIPK4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIPK4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RIPK4

Target: RIPK4 (Receptor-Interacting Serine-threonine Kinase 4 (RIPK4))

Andere Bezeichnung: RIPK4 (RIPK4 Produkte)

Synonyme: dik antikoerper, pkk antikoerper, rip4 antikoerper, ankk2 antikoerper, ankrd3 antikoerper, ripk4a antikoerper, MGC53701 antikoerper, MGC132134 antikoerper, zgc:55705 antikoerper, wu:fj80b10 antikoerper, ripk4b antikoerper, RIPK4 antikoerper, ANKK2 antikoerper, ANKRD3 antikoerper, DIK antikoerper, NKRD3 antikoerper, PKK antikoerper, PPS2 antikoerper, RIP4 antikoerper, 2310069J12Rik antikoerper, AI552420 antikoerper, Ankrd3 antikoerper, DIk antikoerper, receptor interacting serine/threonine kinase 4 L homeolog antikoerper, receptor-interacting serine-threonine kinase 4 antikoerper, receptor interacting serine/threonine kinase 4 antikoerper, receptor interacting serine/threonine kinase 4 S homeolog antikoerper, ripk4.L antikoerper, ripk4 antikoerper, RIPK4 antikoerper, ripk4.S antikoerper, Ripk4 antikoerper

Hintergrund: RIPK4 is a serine/threonine protein kinase that interacts with protein kinase C-delta. The protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation.

Molekulargewicht: 86 kDa (MW of target protein)