Carabin Antikörper (N-Term)
-
- Target Alle Carabin (TBC1D10C) Antikörper anzeigen
- Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Carabin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TBC1 D11 antibody was raised against the N terminal of TBC1 11
- Aufreinigung
- Affinity purified
- Immunogen
- TBC1 D11 antibody was raised using the N terminal of TBC1 11 corresponding to a region with amino acids MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP
- Top Product
- Discover our top product TBC1D10C Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TBC1D10C Blocking Peptide, catalog no. 33R-5723, is also available for use as a blocking control in assays to test for specificity of this TBC1D10C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))
- Andere Bezeichnung
- TBC1D10C (TBC1D10C Produkte)
- Synonyme
- CARABIN antikoerper, EPI64C antikoerper, 1810062O14Rik antikoerper, AI428527 antikoerper, RGD1311490 antikoerper, TBC1 domain family member 10C antikoerper, TBC1 domain family, member 10c antikoerper, TBC1 domain family, member 10C antikoerper, TBC1D10C antikoerper, Tbc1d10c antikoerper
- Hintergrund
- TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.
- Molekulargewicht
- 50 kDa (MW of target protein)
-