Caldesmon Antikörper (C-Term)

Produktnummer ABIN631993

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Caldesmon in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Caldesmon Antikörper (C-Term) (ABIN631993)

Target: Caldesmon (CALD1) (Caldesmon 1 (CALD1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Caldesmon Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Caldesmon Antikörper

Bindungsspezifität: C-Term

Spezifität: Caldesmon 1 antibody was raised against the C terminal of CALD1

Aufreinigung: Affinity purified

Immunogen: Caldesmon 1 antibody was raised using the C terminal of CALD1 corresponding to a region with amino acids VLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Caldesmon 1 Blocking Peptide, (ABIN5612578), is also available for use as a blocking control in assays to test for specificity of this Caldesmon 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Caldesmon

Target: Caldesmon (CALD1) (Caldesmon 1 (CALD1))

Andere Bezeichnung: Caldesmon 1

Hintergrund: CALD1 is a calmodulin- and actin-binding protein that plays an essential role in the regulation of smooth muscle and nonmuscle contraction. The conserved domain of this protein possesses the binding activities to Ca(2+)-calmodulin, actin, tropomyosin, myosin, and phospholipids.

Molekulargewicht: 93 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction